SMPD2 antibody (70R-1809)

Rabbit polyclonal SMPD2 antibody

Synonyms Polyclonal SMPD2 antibody, Anti-SMPD2 antibody, Neutral Sphingomyelinase antibody, SMPD-2, SMPD2, NSMASE antibody, SMPD 2 antibody, Sphingomyelin Phosphodiesterase 2 Neutral Membrane antibody, SMPD 2, SMPD-2 antibody
Cross Reactivity Human
Applications WB
Immunogen SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
Assay Information SMPD2 Blocking Peptide, catalog no. 33R-8123, is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SMPD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors