SMPDL3B antibody (70R-5357)

Rabbit polyclonal SMPDL3B antibody raised against the N terminal of SMPDL3B

Synonyms Polyclonal SMPDL3B antibody, Anti-SMPDL3B antibody, Sphingomyelin Phosphodiesterase Acid-Like 3B antibody, SMPDLB 3 antibody, SMPDLB-3, SMPDLB 3, SMPDL3B, SMPDLB-3 antibody
Specificity SMPDL3B antibody was raised against the N terminal of SMPDL3B
Cross Reactivity Human
Applications IHC, WB
Immunogen SMPDL3B antibody was raised using the N terminal of SMPDL3B corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
Assay Information SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody


Immunohistochemical staining using SMPDL3B antibody (70R-5357)

SMPDL3B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal vilIus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMPDL3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SMPDL3B antibody (70R-5357) | SMPDL3B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal vilIus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using SMPDL3B antibody (70R-5357) | SMPDL3B antibody (70R-5357) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors