SMU1 antibody (70R-4370)

Rabbit polyclonal SMU1 antibody

Synonyms Polyclonal SMU1 antibody, Anti-SMU1 antibody, SMU-1 antibody, SMU-1, FLJ10870 antibody, RP11-54K16.3 antibody, MGC117363 antibody, SMU 1 antibody, FLJ11970 antibody, Smu-1 Suppressor Of Mec-8 And Unc-52 Homolog antibody, DKFZp761L0916 antibody, FLJ10805 antibody, SMU1, SMU-1 antibody, SMU 1, BWD antibody
Cross Reactivity Human
Applications WB
Immunogen SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV
Assay Information SMU1 Blocking Peptide, catalog no. 33R-4615, is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody


Western Blot analysis using SMU1 antibody (70R-4370)

SMU1 antibody (70R-4370) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SMU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SMU1 antibody (70R-4370) | SMU1 antibody (70R-4370) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors