SNAG1 antibody (70R-5764)

Rabbit polyclonal SNAG1 antibody raised against the N terminal Of Snag1

Synonyms Polyclonal SNAG1 antibody, Anti-SNAG1 antibody, FLJ32560 antibody, SNAG-1, FLJ11997 antibody, MGC150829 antibody, SNAG 1, SNAG 1 antibody, MGC150827 antibody, SNX18 antibody, SH3PX2 antibody, SNAG1, SNAG-1 antibody, SH3PXD3B antibody
Specificity SNAG1 antibody was raised against the N terminal Of Snag1
Cross Reactivity Human
Applications WB
Immunogen SNAG1 antibody was raised using the N terminal Of Snag1 corresponding to a region with amino acids LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD
Assay Information SNAG1 Blocking Peptide, catalog no. 33R-5183, is also available for use as a blocking control in assays to test for specificity of this SNAG1 antibody

Images

Western Blot analysis using SNAG1 antibody (70R-5764)

SNAG1 antibody (70R-5764) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNAG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SNAG1 antibody (70R-5764) | SNAG1 antibody (70R-5764) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors