SNRP70 antibody (70R-4901)

Rabbit polyclonal SNRP70 antibody

Synonyms Polyclonal SNRP70 antibody, Anti-SNRP70 antibody, SNRP 70 antibody, U170K antibody, SNRP70, U1AP antibody, Small Nuclear Ribonucleoprotein 70Kda Polypeptide antibody, U1RNP antibody, SNRP 70, SNRP-70, Rnp Antigen antibody, RPU1 antibody, SNRP-70 antibody, RNPU1Z antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS
Assay Information SNRP70 Blocking Peptide, catalog no. 33R-7148, is also available for use as a blocking control in assays to test for specificity of this SNRP70 antibody

Images

Immunohistochemical staining using SNRP70 antibody (70R-4901)

SNRP70 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRP70 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SNRP70 antibody (70R-4901) | SNRP70 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SNRP70 antibody (70R-4901) | SNRP70 antibody (70R-4901) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors