SNRPD1 antibody (70R-4701)

Rabbit polyclonal SNRPD1 antibody raised against the N terminal of SNRPD1

Synonyms Polyclonal SNRPD1 antibody, Anti-SNRPD1 antibody, Small Nuclear Ribonucleoprotein D1 Polypeptide 16Kda antibody
Specificity SNRPD1 antibody was raised against the N terminal of SNRPD1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SNRPD1 antibody was raised using the N terminal of SNRPD1 corresponding to a region with amino acids NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
Assay Information SNRPD1 Blocking Peptide, catalog no. 33R-6711, is also available for use as a blocking control in assays to test for specificity of this SNRPD1 antibody


Immunohistochemical staining using SNRPD1 antibody (70R-4701)

SNRPD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SNRPD1 antibody (70R-4701) | SNRPD1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SNRPD1 antibody (70R-4701) | SNRPD1 antibody (70R-4701) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors