SNRPD2 antibody (70R-4666)

Rabbit polyclonal SNRPD2 antibody raised against the N terminal of SNRPD2

Synonyms Polyclonal SNRPD2 antibody, Anti-SNRPD2 antibody, SMD2 antibody, SNRPD1 antibody, Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5Kda antibody
Specificity SNRPD2 antibody was raised against the N terminal of SNRPD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SNRPD2 antibody was raised using the N terminal of SNRPD2 corresponding to a region with amino acids MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK
Assay Information SNRPD2 Blocking Peptide, catalog no. 33R-6463, is also available for use as a blocking control in assays to test for specificity of this SNRPD2 antibody


Western Blot analysis using SNRPD2 antibody (70R-4666)

SNRPD2 antibody (70R-4666) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SNRPD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SNRPD2 antibody (70R-4666) | SNRPD2 antibody (70R-4666) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors