SOCS1 antibody (70R-5877)

Rabbit polyclonal SOCS1 antibody raised against the middle region of SOCS1

Synonyms Polyclonal SOCS1 antibody, Anti-SOCS1 antibody, SSI1 antibody, SOCS-1, TIP3 antibody, SSI-1 antibody, Suppressor Of Cytokine Signaling 1 antibody, SOCS-1 antibody, SOCS-1 antibody, JAB antibody, CIS1 antibody, CISH1 antibody, SOCS 1, SOCS 1 antibody, SOCS1
Specificity SOCS1 antibody was raised against the middle region of SOCS1
Cross Reactivity Human
Applications WB
Immunogen SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
Assay Information SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody

Images

Western Blot analysis using SOCS1 antibody (70R-5877)

SOCS1 antibody (70R-5877) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SOCS1 antibody (70R-5877) | SOCS1 antibody (70R-5877) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors