Sonic Hedgehog antibody (70R-7123)

Rabbit polyclonal Sonic Hedgehog antibody

Synonyms Polyclonal Sonic Hedgehog antibody, Anti-Sonic Hedgehog antibody, HLP3 antibody, TPT antibody, HHG1 antibody, TPTPS antibody, SMMCI antibody, HPE3 antibody, Sonic Hedgehog Homolog antibody, SHH antibody
Cross Reactivity Human,Mouse,Dog,ZebraFish
Applications IHC, WB
Immunogen Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Assay Information Sonic Hedgehog Blocking Peptide, catalog no. 33R-7837, is also available for use as a blocking control in assays to test for specificity of this Sonic Hedgehog antibody

Images

Immunohistochemical staining using Sonic Hedgehog antibody (70R-7123)

Sonic Hedgehog antibody used at a dilution of 1:1000 to stain Chicken Embryos.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SHH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Sonic Hedgehog antibody (70R-7123) | Sonic Hedgehog antibody used at a dilution of 1:1000 to stain Chicken Embryos.
  • Western Blot analysis using Sonic Hedgehog antibody (70R-7123) | Sonic Hedgehog antibody (70R-7123) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors