SPAG11B antibody (70R-5320)

Rabbit polyclonal SPAG11B antibody raised against the N terminal of SPAG11B

Synonyms Polyclonal SPAG11B antibody, Anti-SPAG11B antibody, EP2D antibody, SPAGB-11 antibody, EP2 antibody, HE2 antibody, SPAG11B, SPAG11 antibody, SPAGB 11, HE2C antibody, MGC61846 antibody, EP2C antibody, Sperm Associated Antigen 11B antibody, SPAGB 11 antibody, SPAGB-11
Specificity SPAG11B antibody was raised against the N terminal of SPAG11B
Cross Reactivity Human
Applications WB
Immunogen SPAG11B antibody was raised using the N terminal of SPAG11B corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG
Assay Information SPAG11B Blocking Peptide, catalog no. 33R-6377, is also available for use as a blocking control in assays to test for specificity of this SPAG11B antibody

Images

Western Blot analysis using SPAG11B antibody (70R-5320)

SPAG11B antibody (70R-5320) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPAG11B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPAG11B antibody (70R-5320) | SPAG11B antibody (70R-5320) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors