SPAG6 antibody (70R-3424)

Rabbit polyclonal SPAG6 antibody raised against the middle region of SPAG6

Synonyms Polyclonal SPAG6 antibody, Anti-SPAG6 antibody, DKFZp434I153 antibody, Sperm Associated Antigen 6 antibody, SPAG6, pf16 antibody, Repro-SA-1 antibody, SPAG 6, SPAG 6 antibody, SPAG-6, MGC26276 antibody, SPAG-6 antibody
Specificity SPAG6 antibody was raised against the middle region of SPAG6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
Assay Information SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody

Images

Western Blot analysis using SPAG6 antibody (70R-3424)

SPAG6 antibody (70R-3424) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPAG6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPAG6 antibody (70R-3424) | SPAG6 antibody (70R-3424) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors