SPATA17 antibody (70R-3187)

Rabbit polyclonal SPATA17 antibody raised against the C terminal of SPATA17

Synonyms Polyclonal SPATA17 antibody, Anti-SPATA17 antibody, SPATA-17 antibody, Spermatogenesis Associated 17 antibody, SPATA-17, SPATA 17, SPATA17, IQCH antibody, RP11-144C20.1 antibody, MSRG11 antibody, MSRG-11 antibody, SPATA 17 antibody
Specificity SPATA17 antibody was raised against the C terminal of SPATA17
Cross Reactivity Human
Applications WB
Immunogen SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT
Assay Information SPATA17 Blocking Peptide, catalog no. 33R-6793, is also available for use as a blocking control in assays to test for specificity of this SPATA17 antibody

Images

Western Blot analysis using SPATA17 antibody (70R-3187)

SPATA17 antibody (70R-3187) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPATA17 antibody (70R-3187) | SPATA17 antibody (70R-3187) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors