SPATA2L antibody (70R-3641)

Rabbit polyclonal SPATA2L antibody raised against the middle region of SPATA2L

Synonyms Polyclonal SPATA2L antibody, Anti-SPATA2L antibody, tamo antibody, SPATA2L, SPATAL-2 antibody, SPATAL-2, Spermatogenesis Associated 2-Like antibody, SPATAL 2 antibody, C16orf76 antibody, MGC26885 antibody, SPATAL 2
Specificity SPATA2L antibody was raised against the middle region of SPATA2L
Cross Reactivity Human
Applications WB
Immunogen SPATA2L antibody was raised using the middle region of SPATA2L corresponding to a region with amino acids SPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGLE
Assay Information SPATA2L Blocking Peptide, catalog no. 33R-8686, is also available for use as a blocking control in assays to test for specificity of this SPATA2L antibody

Images

Western Blot analysis using SPATA2L antibody (70R-3641)

SPATA2L antibody (70R-3641) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA2L belongs to the SPATA2 family. The exact function of SPATA2L is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPATA2L antibody (70R-3641) | SPATA2L antibody (70R-3641) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors