SPATA6 antibody (70R-3951)

Rabbit polyclonal SPATA6 antibody raised against the middle region of SPATA6

Synonyms Polyclonal SPATA6 antibody, Anti-SPATA6 antibody, SRF1 antibody, Spermatogenesis Associated 6 antibody, SPATA-6, SRF-1 antibody, SPATA6, SPATA 6, FLJ10007 antibody, SPATA 6 antibody, SPATA-6 antibody
Specificity SPATA6 antibody was raised against the middle region of SPATA6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPATA6 antibody was raised using the middle region of SPATA6 corresponding to a region with amino acids SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR
Assay Information SPATA6 Blocking Peptide, catalog no. 33R-8715, is also available for use as a blocking control in assays to test for specificity of this SPATA6 antibody


Western Blot analysis using SPATA6 antibody (70R-3951)

SPATA6 antibody (70R-3951) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPATA6 antibody (70R-3951) | SPATA6 antibody (70R-3951) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors