SPATA7 antibody (70R-4374)

Rabbit polyclonal SPATA7 antibody raised against the middle region of SPATA7

Synonyms Polyclonal SPATA7 antibody, Anti-SPATA7 antibody, SPATA7, SPATA 7 antibody, SPATA-7 antibody, HSD-3.1 antibody, HSD3 antibody, SPATA 7, SPATA-7, MGC102934 antibody, Spermatogenesis Associated 7 antibody, DKFZp686D07199 antibody
Specificity SPATA7 antibody was raised against the middle region of SPATA7
Cross Reactivity Human
Applications WB
Immunogen SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN
Assay Information SPATA7 Blocking Peptide, catalog no. 33R-2989, is also available for use as a blocking control in assays to test for specificity of this SPATA7 antibody

Images

Western Blot analysis using SPATA7 antibody (70R-4374)

SPATA7 antibody (70R-4374) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance the gene which encodes the SPATA7 protein is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPATA7 antibody (70R-4374) | SPATA7 antibody (70R-4374) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors