SPATA9 antibody (70R-6752)

Rabbit polyclonal SPATA9 antibody raised against the N terminal of SPATA9

Synonyms Polyclonal SPATA9 antibody, Anti-SPATA9 antibody, FLJ35906 antibody, SPATA9, NYD-SP16 antibody, Spermatogenesis Associated 9 antibody, SPATA-9 antibody, SPATA 9 antibody, SPATA 9, SPATA-9
Specificity SPATA9 antibody was raised against the N terminal of SPATA9
Cross Reactivity Human
Applications WB
Immunogen SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR
Assay Information SPATA9 Blocking Peptide, catalog no. 33R-2943, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody


Western Blot analysis using SPATA9 antibody (70R-6752)

SPATA9 antibody (70R-6752) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPATA9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPATA9 antibody (70R-6752) | SPATA9 antibody (70R-6752) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors