SPG20 antibody (70R-3161)

Rabbit polyclonal SPG20 antibody

Synonyms Polyclonal SPG20 antibody, Anti-SPG20 antibody, SPG-20, SPG 20 antibody, SPG 20, KIAA0610 antibody, SPG20, SPG-20 antibody, TAHCCP1 antibody, SPARTIN antibody, Spastic Paraplegia 20 antibody, Troyer Syndrome antibody
Cross Reactivity Human
Applications WB
Immunogen SPG20 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA
Assay Information SPG20 Blocking Peptide, catalog no. 33R-1544, is also available for use as a blocking control in assays to test for specificity of this SPG20 antibody


Western Blot analysis using SPG20 antibody (70R-3161)

SPG20 antibody (70R-3161) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPG20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPG20 antibody (70R-3161) | SPG20 antibody (70R-3161) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors