SPINK1 antibody (70R-5308)

Rabbit polyclonal SPINK1 antibody raised against the N terminal of SPINK1

Synonyms Polyclonal SPINK1 antibody, Anti-SPINK1 antibody, TATI antibody, SPINK1, PCTT antibody, SPINK-1 antibody, PSTI antibody, Serine Peptidase Inhibitor Kazal Type 1 antibody, SPINK 1 antibody, SPINK 1, SPINK-1, Spink3 antibody
Specificity SPINK1 antibody was raised against the N terminal of SPINK1
Cross Reactivity Human
Applications WB
Immunogen SPINK1 antibody was raised using the N terminal of SPINK1 corresponding to a region with amino acids KVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG
Assay Information SPINK1 Blocking Peptide, catalog no. 33R-4724, is also available for use as a blocking control in assays to test for specificity of this SPINK1 antibody

Images

Western Blot analysis using SPINK1 antibody (70R-5308)

SPINK1 antibody (70R-5308) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 8 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPINK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPINK1 is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPINK1 antibody (70R-5308) | SPINK1 antibody (70R-5308) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors