SPINT1 antibody (70R-6833)

Rabbit polyclonal SPINT1 antibody raised against the middle region of SPINT1

Synonyms Polyclonal SPINT1 antibody, Anti-SPINT1 antibody, SPINT 1, SPINT 1 antibody, HAI antibody, Serine Peptidase Inhibitor Kunitz Type 1 antibody, SPINT-1 antibody, MANSC2 antibody, SPINT-1, SPINT1, HAI1 antibody
Specificity SPINT1 antibody was raised against the middle region of SPINT1
Cross Reactivity Human
Applications WB
Immunogen SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS
Assay Information SPINT1 Blocking Peptide, catalog no. 33R-7084, is also available for use as a blocking control in assays to test for specificity of this SPINT1 antibody

Images

Western Blot analysis using SPINT1 antibody (70R-6833)

SPINT1 antibody (70R-6833) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPINT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPINT1 antibody (70R-6833) | SPINT1 antibody (70R-6833) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors