SPINT2 antibody (70R-7322)

Rabbit polyclonal SPINT2 antibody raised against the middle region of SPINT2

Synonyms Polyclonal SPINT2 antibody, Anti-SPINT2 antibody, Kop antibody, SPINT-2, Serine Peptidase Inhibitor Kunitz Type 2 antibody, HAI2 antibody, SPINT 2, SPINT 2 antibody, SPINT-2 antibody, SPINT2, HAI-2 antibody, PB antibody
Specificity SPINT2 antibody was raised against the middle region of SPINT2
Cross Reactivity Human
Applications WB
Immunogen SPINT2 antibody was raised using the middle region of SPINT2 corresponding to a region with amino acids MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE
Assay Information SPINT2 Blocking Peptide, catalog no. 33R-6208, is also available for use as a blocking control in assays to test for specificity of this SPINT2 antibody

Images

Western Blot analysis using SPINT2 antibody (70R-7322)

SPINT2 antibody (70R-7322) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPINT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the kDa-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPINT2 antibody (70R-7322) | SPINT2 antibody (70R-7322) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors