SPNS1 antibody (70R-6917)

Rabbit polyclonal SPNS1 antibody

Synonyms Polyclonal SPNS1 antibody, Anti-SPNS1 antibody, SPNS 1, HSpin1 antibody, SPNS-1, Spinster Homolog 1 antibody, LAT antibody, FLJ38358 antibody, nrs antibody, PP2030 antibody, SPNS-1 antibody, SPNS1, SPINL antibody, SPIN1 antibody, SPNS 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPNS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRIT
Assay Information SPNS1 Blocking Peptide, catalog no. 33R-1219, is also available for use as a blocking control in assays to test for specificity of this SPNS1 antibody


Western Blot analysis using SPNS1 antibody (70R-6917)

SPNS1 antibody (70R-6917) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPNS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPNS1 is the Sphingolipid transporter. It may be involved in necrotic or autophagic cell death. It belongs to the major facilitator superfamily, spinster family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPNS1 antibody (70R-6917) | SPNS1 antibody (70R-6917) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors