SPO11 antibody (70R-5594)

Rabbit polyclonal SPO11 antibody

Synonyms Polyclonal SPO11 antibody, Anti-SPO11 antibody, SPO 11, MGC39953 antibody, SPO11, SPO-11 antibody, SPO 11 antibody, SPO-11, Spo11 Meiotic Protein Covalently Bound To Dsb Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC
Assay Information SPO11 Blocking Peptide, catalog no. 33R-4380, is also available for use as a blocking control in assays to test for specificity of this SPO11 antibody

Images

Western Blot analysis using SPO11 antibody (70R-5594)

SPO11 antibody (70R-5594) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPO11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPO11 antibody (70R-5594) | SPO11 antibody (70R-5594) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors