SPOCK3 antibody (70R-6593)

Rabbit polyclonal SPOCK3 antibody

Synonyms Polyclonal SPOCK3 antibody, Anti-SPOCK3 antibody, Sparc/Osteonectin Cwcv And Kazal-Like Domains Proteoglycan antibody, SPOCK 3, SPOCK-3, SPOCK-3 antibody, Testican 3 antibody, TES-3 antibody, SPOCK 3 antibody, SPOCK3, HSAJ1454 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT
Assay Information SPOCK3 Blocking Peptide, catalog no. 33R-1758, is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody


Western Blot analysis using SPOCK3 antibody (70R-6593)

SPOCK3 antibody (70R-6593) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPOCK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding family Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPOCK3 antibody (70R-6593) | SPOCK3 antibody (70R-6593) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors