SPON2 antibody (70R-6084)

Rabbit polyclonal SPON2 antibody raised against the middle region of SPON2

Synonyms Polyclonal SPON2 antibody, Anti-SPON2 antibody, DIL1 antibody, SPON2, M-spondin antibody, SPON 2 antibody, DIL-1 antibody, SPON-2 antibody, Spondin 2 Extracellular Matrix Protein antibody, SPON 2, SPON-2, Mindin antibody
Specificity SPON2 antibody was raised against the middle region of SPON2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPON2 antibody was raised using the middle region of SPON2 corresponding to a region with amino acids GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV
Assay Information SPON2 Blocking Peptide, catalog no. 33R-3604, is also available for use as a blocking control in assays to test for specificity of this SPON2 antibody


Western Blot analysis using SPON2 antibody (70R-6084)

SPON2 antibody (70R-6084) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPON2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPON2 antibody (70R-6084) | SPON2 antibody (70R-6084) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors