SPP1 antibody (70R-6095)

Rabbit polyclonal SPP1 antibody

Synonyms Polyclonal SPP1 antibody, Anti-SPP1 antibody, SPP 1, OPN antibody, SPP1, Osteopontin Bone Sialoprotein I Early T-Lymphocyte Activation 1 antibody, SPP 1 antibody, ETA-1 antibody, SPP-1 antibody, SPP-1, BNSP antibody, MGC110940 antibody, Secreted Phosphoprotein 1 antibody, BSPI antibody
Cross Reactivity Human
Applications WB
Immunogen SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ
Assay Information SPP1 Blocking Peptide, catalog no. 33R-6363, is also available for use as a blocking control in assays to test for specificity of this SPP1 antibody

Images

Western blot analysis using SPP1 antibody (70R-6095)

Recommended SPP1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SPP1 antibody (70R-6095) | Recommended SPP1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors