SPPL2B antibody (70R-6412)

Rabbit polyclonal SPPL2B antibody raised against the N terminal of SPPL2B

Synonyms Polyclonal SPPL2B antibody, Anti-SPPL2B antibody, SPPLB-2, SPPLB-2 antibody, SPPLB 2 antibody, MGC111084 antibody, Signal Peptide Peptidase-Like 2B antibody, SPPL2B, SPPLB 2, IMP4 antibody, PSL1 antibody, KIAA1532 antibody
Specificity SPPL2B antibody was raised against the N terminal of SPPL2B
Cross Reactivity Human
Applications IHC, WB
Immunogen SPPL2B antibody was raised using the N terminal of SPPL2B corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
Assay Information SPPL2B Blocking Peptide, catalog no. 33R-9434, is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody

Images

Immunohistochemical staining using SPPL2B antibody (70R-6412)

SPPL2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPPL2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SPPL2B antibody (70R-6412) | SPPL2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SPPL2B antibody (70R-6412) | SPPL2B antibody (70R-6412) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using SPPL2B antibody (70R-6412) | SPPL2B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors