SPRR3 antibody (70R-3927)

Rabbit polyclonal SPRR3 antibody raised against the middle region of SPRR3

Synonyms Polyclonal SPRR3 antibody, Anti-SPRR3 antibody, SPRR-3 antibody, Small Proline-Rich Protein 3 antibody, SPRR-3, SPRR 3, SPRR 3 antibody, SPRR3
Specificity SPRR3 antibody was raised against the middle region of SPRR3
Cross Reactivity Human
Applications WB
Immunogen SPRR3 antibody was raised using the middle region of SPRR3 corresponding to a region with amino acids DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ
Assay Information SPRR3 Blocking Peptide, catalog no. 33R-2129, is also available for use as a blocking control in assays to test for specificity of this SPRR3 antibody


Western Blot analysis using SPRR3 antibody (70R-3927)

SPRR3 antibody (70R-3927) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPRR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SPRR3 is the cross-linked envelope protein of keratinocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SPRR3 antibody (70R-3927) | SPRR3 antibody (70R-3927) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors