SPTLC1 antibody (70R-6554)

Rabbit polyclonal SPTLC1 antibody raised against the middle region of SPTLC1

Synonyms Polyclonal SPTLC1 antibody, Anti-SPTLC1 antibody, SPTI antibody, SPTLC 1, HSAN antibody, MGC14645 antibody, HSN1 antibody, SPT1 antibody, HSAN1 antibody, LBC1 antibody, LCB1 antibody, Serine Palmitoyltransferase Long Chain Base Subunit 1 antibody, SPTLC-1, SPTLC1, SPTLC 1 antibody, SPTLC-1 antibody
Specificity SPTLC1 antibody was raised against the middle region of SPTLC1
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI
Assay Information SPTLC1 Blocking Peptide, catalog no. 33R-3905, is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Images

Immunohistochemical staining using SPTLC1 antibody (70R-6554)

SPTLC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPTLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SPTLC1 antibody (70R-6554) | SPTLC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SPTLC1 antibody (70R-6554) | SPTLC1 antibody (70R-6554) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SPTLC1 antibody (70R-6554) | SPTLC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors