SPTLC1 antibody (70R-6555)

Rabbit polyclonal SPTLC1 antibody raised against the middle region of SPTLC1

Synonyms Polyclonal SPTLC1 antibody, Anti-SPTLC1 antibody, HSN1 antibody, SPTI antibody, SPT1 antibody, LBC1 antibody, HSAN1 antibody, MGC14645 antibody, SPTLC 1, SPTLC-1 antibody, SPTLC-1, SPTLC 1 antibody, LCB1 antibody, HSAN antibody, Serine Palmitoyltransferase Long Chain Base Subunit 1 antibody, SPTLC1
Specificity SPTLC1 antibody was raised against the middle region of SPTLC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY
Assay Information SPTLC1 Blocking Peptide, catalog no. 33R-2041, is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Images

Western Blot analysis using SPTLC1 antibody (70R-6555)

SPTLC1 antibody (70R-6555) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPTLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SPTLC1 antibody (70R-6555) | SPTLC1 antibody (70R-6555) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors