SR140 antibody (70R-4844)

Rabbit polyclonal SR140 antibody raised against the middle region of SR140

Synonyms Polyclonal SR140 antibody, Anti-SR140 antibody, SR 140, KIAA0332 antibody, U2-Associated Sr140 Protein antibody, SR140, MGC133197 antibody, SR 140 antibody, SR-140 antibody, SR-140
Specificity SR140 antibody was raised against the middle region of SR140
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SR140 antibody was raised using the middle region of SR140 corresponding to a region with amino acids KVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEE
Assay Information SR140 Blocking Peptide, catalog no. 33R-4699, is also available for use as a blocking control in assays to test for specificity of this SR140 antibody


Western Blot analysis using SR140 antibody (70R-4844)

SR140 antibody (70R-4844) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 118 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SR140 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of SR140 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SR140 antibody (70R-4844) | SR140 antibody (70R-4844) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors