SRBD1 antibody (70R-4956)

Rabbit polyclonal SRBD1 antibody raised against the N terminal of SRBD1

Synonyms Polyclonal SRBD1 antibody, Anti-SRBD1 antibody, SRBD 1 antibody, S1 Rna Binding Domain 1 antibody, FLJ10379 antibody, SRBD-1 antibody, SRBD-1, SRBD1, SRBD 1
Specificity SRBD1 antibody was raised against the N terminal of SRBD1
Cross Reactivity Human
Applications WB
Immunogen SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS
Assay Information SRBD1 Blocking Peptide, catalog no. 33R-6501, is also available for use as a blocking control in assays to test for specificity of this SRBD1 antibody


Western Blot analysis using SRBD1 antibody (70R-4956)

SRBD1 antibody (70R-4956) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 112 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRBD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRBD1 contains 1 S1 motif domain. The exact function of SRBD1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SRBD1 antibody (70R-4956) | SRBD1 antibody (70R-4956) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors