SRD5A2 antibody (70R-6434)

Rabbit polyclonal SRD5A2 antibody

Synonyms Polyclonal SRD5A2 antibody, Anti-SRD5A2 antibody, SRDA2-5 antibody, 3-Oxo-5 Alpha-Steroid Delta 4-Dehydrogenase Alpha 2 antibody, SRDA2 5 antibody, SRD5A2, MGC138457 antibody, SRDA2 5, Steroid-5-Alpha-Reductase Alpha Polypeptide 2 antibody, SRDA2-5
Cross Reactivity Human
Applications WB
Immunogen SRD5A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL
Assay Information SRD5A2 Blocking Peptide, catalog no. 33R-4423, is also available for use as a blocking control in assays to test for specificity of this SRD5A2 antibody

Images

Western Blot analysis using SRD5A2 antibody (70R-6434)

SRD5A2 antibody (70R-6434) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRD5A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SRD5A2 antibody (70R-6434) | SRD5A2 antibody (70R-6434) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors