SRD5A3 antibody (70R-7438)

Rabbit polyclonal SRD5A3 antibody raised against the N terminal of SRD5A3

Synonyms Polyclonal SRD5A3 antibody, Anti-SRD5A3 antibody, SRDA3 5, SRD5A2L antibody, FLJ13352 antibody, SRD5A3, Steroid 5 Alpha-Reductase 3 antibody, SRDA3 5 antibody, SRDA3-5 antibody, SRDA3-5
Specificity SRD5A3 antibody was raised against the N terminal of SRD5A3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SRD5A3 antibody was raised using the N terminal of SRD5A3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN
Assay Information SRD5A3 Blocking Peptide, catalog no. 33R-3408, is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Images

Western Blot analysis using SRD5A3 antibody (70R-7438)

SRD5A3 antibody (70R-7438) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRD5A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SRD5A3 antibody (70R-7438) | SRD5A3 antibody (70R-7438) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors