SRPR antibody (70R-5029)

Rabbit polyclonal SRPR antibody

Synonyms Polyclonal SRPR antibody, Anti-SRPR antibody, MGC17355 antibody, SRP-alpha antibody, Docking protein antibody, Docking Protein antibody, MGC3650 antibody, DP antibody, MGC9571 antibody, Sralpha antibody, Signal Recognition Particle Receptor antibody
Cross Reactivity Human
Applications WB
Immunogen SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP
Assay Information SRPR Blocking Peptide, catalog no. 33R-2356, is also available for use as a blocking control in assays to test for specificity of this SRPR antibody

Images

Western Blot analysis using SRPR antibody (70R-5029)

SRPR antibody (70R-5029) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRPR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRPR belongs to the GTP-binding SRP family. It is in conjunction with SRP, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SRPR antibody (70R-5029) | SRPR antibody (70R-5029) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors