SRPRB antibody (70R-6615)

Rabbit polyclonal SRPRB antibody raised against the middle region of SRPRB

Synonyms Polyclonal SRPRB antibody, Anti-SRPRB antibody, APMCF1 antibody, Signal Recognition Particle Receptor B Subunit antibody
Specificity SRPRB antibody was raised against the middle region of SRPRB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SRPRB antibody was raised using the middle region of SRPRB corresponding to a region with amino acids QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Assay Information SRPRB Blocking Peptide, catalog no. 33R-7499, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody


Western Blot analysis using SRPRB antibody (70R-6615)

SRPRB antibody (70R-6615) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRPRB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SRPRB antibody (70R-6615) | SRPRB antibody (70R-6615) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors