SRRD antibody (70R-3668)

Rabbit polyclonal SRRD antibody raised against the middle region of SRRD

Synonyms Polyclonal SRRD antibody, Anti-SRRD antibody, HC/HCC antibody, srr1l antibody, Srr1 Domain Containing antibody
Specificity SRRD antibody was raised against the middle region of SRRD
Cross Reactivity Human
Applications WB
Immunogen SRRD antibody was raised using the middle region of SRRD corresponding to a region with amino acids DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA
Assay Information SRRD Blocking Peptide, catalog no. 33R-1995, is also available for use as a blocking control in assays to test for specificity of this SRRD antibody

Images

Western Blot analysis using SRRD antibody (70R-3668)

SRRD antibody (70R-3668) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SRRD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SRRD antibody (70R-3668) | SRRD antibody (70R-3668) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors