SSB antibody (70R-1427)

Rabbit polyclonal SSB antibody

Synonyms Polyclonal SSB antibody, Anti-SSB antibody, Autoantigen La antibody, La antibody, Sjogren Syndrome Antigen B antibody, LARP3 antibody
Cross Reactivity Human
Applications WB
Immunogen SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids PGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEED
Assay Information SSB Blocking Peptide, catalog no. 33R-7124, is also available for use as a blocking control in assays to test for specificity of this SSB antibody


Western Blot analysis using SSB antibody (70R-1427)

SSB antibody (70R-1427) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SSB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SSB antibody (70R-1427) | SSB antibody (70R-1427) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors