SSB antibody (70R-4891)

Rabbit polyclonal SSB antibody

Synonyms Polyclonal SSB antibody, Anti-SSB antibody, LARP3 antibody, Autoantigen La antibody, Sjogren Syndrome Antigen B antibody, La antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL
Assay Information SSB Blocking Peptide, catalog no. 33R-4149, is also available for use as a blocking control in assays to test for specificity of this SSB antibody

Images

Immunohistochemical staining using SSB antibody (70R-4891)

SSB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SSB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SSB antibody (70R-4891) | SSB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using SSB antibody (70R-4891) | SSB antibody (70R-4891) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors