SSBP1 Blocking Peptide (33R-10337)

A synthetic peptide for use as a blocking control in assays to test for specificity of SSBP1 antibody, catalog no. 70R-10403

Synonyms SSBP1 control peptide, SSBP1 antibody Blocking Peptide, Anti-SSBP1 Blocking Peptide, single-stranded DNA binding protein 1 Blocking Peptide, SOSS-B1 Blocking Peptide, SSBP Blocking Peptide, SSBP1, SSBP-1, SSBP 1, SSBP-1 Blocking Peptide, SSBP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues HESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMW
Molecular Weight 16 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSBP1 is a housekeeping gene involved in mitochondrial biogenesis. It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors