SSBP3 antibody (70R-3546)

Rabbit polyclonal SSBP3 antibody raised against the middle region of SSBP3

Synonyms Polyclonal SSBP3 antibody, Anti-SSBP3 antibody, SSBP3, Single Stranded Dna Binding Protein 3 antibody, SSBP 3, SSDP antibody, SSBP 3 antibody, SSBP-3 antibody, FLJ10355 antibody, SSBP-3, CSDP antibody, SSDP1 antibody
Specificity SSBP3 antibody was raised against the middle region of SSBP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV
Assay Information SSBP3 Blocking Peptide, catalog no. 33R-1990, is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody


Western Blot analysis using SSBP3 antibody (70R-3546)

SSBP3 antibody (70R-3546) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SSBP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SSBP3 antibody (70R-3546) | SSBP3 antibody (70R-3546) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors