SSR1 antibody (70R-6619)

Rabbit polyclonal SSR1 antibody raised against the middle region of SSR1

Synonyms Polyclonal SSR1 antibody, Anti-SSR1 antibody, SSR-1, SSR1, DKFZp781N23103 antibody, Signal Sequence Receptor Alpha antibody, SSR-1 antibody, SSR 1 antibody, SSR 1, TRAPA antibody
Specificity SSR1 antibody was raised against the middle region of SSR1
Cross Reactivity Human
Applications WB
Immunogen SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY
Assay Information SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody

Images

Western Blot analysis using SSR1 antibody (70R-6619)

SSR1 antibody (70R-6619) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SSR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SSR1 antibody (70R-6619) | SSR1 antibody (70R-6619) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors