SSX2IP antibody (70R-6039)

Rabbit polyclonal SSX2IP antibody raised against the middle region of SSX2IP

Synonyms Polyclonal SSX2IP antibody, Anti-SSX2IP antibody, SSXIP-2, ADIP antibody, SSXIP 2 antibody, SSX2IP, Synovial Sarcoma X Breakpoint 2 Interacting Protein antibody, MGC75026 antibody, SSXIP-2 antibody, KIAA0923 antibody, SSXIP 2, FLJ10848 antibody
Specificity SSX2IP antibody was raised against the middle region of SSX2IP
Cross Reactivity Human
Applications WB
Immunogen SSX2IP antibody was raised using the middle region of SSX2IP corresponding to a region with amino acids KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA
Assay Information SSX2IP Blocking Peptide, catalog no. 33R-4706, is also available for use as a blocking control in assays to test for specificity of this SSX2IP antibody

Images

Immunohistochemical staining using SSX2IP antibody (70R-6039)

SSX2IP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SSX2IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SSX2IP belongs to an adhesion system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). It may connect the nectin-afadin and E-cadherin-catenin system through alpha-actinin and may be involved in organization of the actin cytoskeleton at AJs through afadin and alpha-actinin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SSX2IP antibody (70R-6039) | SSX2IP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SSX2IP antibody (70R-6039) | SSX2IP antibody (70R-6039) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors