ST3GAL1 antibody (70R-7382)

Rabbit polyclonal ST3GAL1 antibody raised against the C terminal of ST3GAL1

Synonyms Polyclonal ST3GAL1 antibody, Anti-ST3GAL1 antibody, STGAL1-3 antibody, ST3GalA antibody, STGAL1 3, SIAT4A antibody, MGC9183 antibody, 1 antibody, ST3GalA.1 antibody, St3 Beta-Galactoside Alpha-23-Sialyltransferase 1 antibody, STGAL1-3, SIATFL antibody, ST3O antibody, ST3GAL1, STGAL1 3 antibody, ST3GalIA antibody, Gal-NAc6S antibody
Specificity ST3GAL1 antibody was raised against the C terminal of ST3GAL1
Cross Reactivity Human,Rat
Applications WB
Immunogen ST3GAL1 antibody was raised using the C terminal of ST3GAL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN
Assay Information ST3GAL1 Blocking Peptide, catalog no. 33R-10274, is also available for use as a blocking control in assays to test for specificity of this ST3GAL1 antibody

Images

Western Blot analysis using ST3GAL1 antibody (70R-7382)

ST3GAL1 antibody (70R-7382) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST3GAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST3GAL1 antibody (70R-7382) | ST3GAL1 antibody (70R-7382) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors