ST3GAL2 antibody (70R-7396)

Rabbit polyclonal ST3GAL2 antibody raised against the C terminal of ST3GAL2

Synonyms Polyclonal ST3GAL2 antibody, Anti-ST3GAL2 antibody, STGAL2-3, SIAT4B antibody, ST3GalA.2 antibody, ST3GAL2, ST3GALII antibody, STGAL2 3 antibody, STGAL2-3 antibody, St3 Beta-Galactoside Alpha-23-Sialyltransferase 2 antibody, STGAL2 3, Gal-NAc6S antibody
Specificity ST3GAL2 antibody was raised against the C terminal of ST3GAL2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ST3GAL2 antibody was raised using the C terminal of ST3GAL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Assay Information ST3GAL2 Blocking Peptide, catalog no. 33R-1106, is also available for use as a blocking control in assays to test for specificity of this ST3GAL2 antibody

Images

Western Blot analysis using ST3GAL2 antibody (70R-7396)

ST3GAL2 antibody (70R-7396) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST3GAL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST3GAL2 antibody (70R-7396) | ST3GAL2 antibody (70R-7396) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors