ST3GAL3 antibody (70R-7392)

Rabbit polyclonal ST3GAL3 antibody raised against the N terminal of ST3GAL3

Synonyms Polyclonal ST3GAL3 antibody, Anti-ST3GAL3 antibody, STGAL-3 antibody, ST3GalIII antibody, St3 Beta-Galactoside Alpha-23-Sialyltransferase 3 antibody, ST3GAL3, STGAL 3, ST3Gal III antibody, ST3GALII antibody, STGAL-3, STGAL 3 antibody, ST3N antibody, SIAT6 antibody
Specificity ST3GAL3 antibody was raised against the N terminal of ST3GAL3
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ST3GAL3 antibody was raised using the N terminal of ST3GAL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK
Assay Information ST3GAL3 Blocking Peptide, catalog no. 33R-6531, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody

Images

Western Blot analysis using ST3GAL3 antibody (70R-7392)

ST3GAL3 antibody (70R-7392) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST3GAL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST3GAL3 antibody (70R-7392) | ST3GAL3 antibody (70R-7392) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors