ST3GAL4 antibody (70R-7331)

Rabbit polyclonal ST3GAL4 antibody raised against the middle region of ST3GAL4

Synonyms Polyclonal ST3GAL4 antibody, Anti-ST3GAL4 antibody, SAT3 antibody, STGAL4-3 antibody, ST3GalIV antibody, CGS23 antibody, ST3Gal IV antibody, ST3GAL4, STZ antibody, STGAL4 3, SIAT4C antibody, STGAL4 3 antibody, FLJ11867 antibody, STGAL4-3, SIAT4 antibody, St3 Beta-Galactoside Alpha-23-Sialyltransferase 4 antibody, NANTA3 antibody
Specificity ST3GAL4 antibody was raised against the middle region of ST3GAL4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM
Assay Information ST3GAL4 Blocking Peptide, catalog no. 33R-4030, is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody

Images

Western Blot analysis using ST3GAL4 antibody (70R-7331)

ST3GAL4 antibody (70R-7331) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST3GAL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST3GAL4 may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST3GAL4 antibody (70R-7331) | ST3GAL4 antibody (70R-7331) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors