ST3GAL5 antibody (70R-1878)

Rabbit polyclonal ST3GAL5 antibody raised against the N terminal of ST3GAL5

Synonyms Polyclonal ST3GAL5 antibody, Anti-ST3GAL5 antibody, SIATGM3S antibody, STGAL5 3, STGAL5-3, St3 Beta-Galactoside Alpha-23-Sialyltransferase 5 antibody, SIAT9 antibody, ST3GAL5, STGAL5-3 antibody, STGAL5 3 antibody, ST3GalV antibody
Specificity ST3GAL5 antibody was raised against the N terminal of ST3GAL5
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Assay Information ST3GAL5 Blocking Peptide, catalog no. 33R-2160, is also available for use as a blocking control in assays to test for specificity of this ST3GAL5 antibody

Images

Immunohistochemical staining using ST3GAL5 antibody (70R-1878)

ST3GAL5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ST3GAL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ST3GAL5 antibody (70R-1878) | ST3GAL5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ST3GAL5 antibody (70R-1878) | ST3GAL5 antibody (70R-1878) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using ST3GAL5 antibody (70R-1878) | ST3GAL5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors