ST6GALNAC1 antibody (70R-7472)

Rabbit polyclonal ST6GALNAC1 antibody

Synonyms Polyclonal ST6GALNAC1 antibody, Anti-ST6GALNAC1 antibody, ST6GALNAC1, SIAT7A antibody, HSY11339 antibody, STGALNAC1 6, STGALNAC1-6 antibody, STGALNAC1-6, ST6GalNAcI antibody, STGALNAC1 6 antibody, St6 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ST6GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
Assay Information ST6GALNAC1 Blocking Peptide, catalog no. 33R-5049, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC1 antibody

Images

Western Blot analysis using ST6GALNAC1 antibody (70R-7472)

ST6GALNAC1 antibody (70R-7472) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST6GALNAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST6GALNAC1 antibody (70R-7472) | ST6GALNAC1 antibody (70R-7472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors