ST6GALNAC2 antibody (70R-7453)

Rabbit polyclonal ST6GALNAC2 antibody raised against the middle region of ST6GALNAC2

Synonyms Polyclonal ST6GALNAC2 antibody, Anti-ST6GALNAC2 antibody, SIAT7 antibody, SIATL1 antibody, STHM antibody, STGALNAC2-6 antibody, STGALNAC2 6, STGALNAC2 6 antibody, St6 -N-Acetylgalactosaminide Alpha-26-Sialyltransferase 2 antibody, ST6GalNAII antibody, SIAT7B antibody, ST6GALNAC2, STGALNAC2-6
Specificity ST6GALNAC2 antibody was raised against the middle region of ST6GALNAC2
Cross Reactivity Human
Applications WB
Immunogen ST6GALNAC2 antibody was raised using the middle region of ST6GALNAC2 corresponding to a region with amino acids VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
Assay Information ST6GALNAC2 Blocking Peptide, catalog no. 33R-9714, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC2 antibody

Images

Western Blot analysis using ST6GALNAC2 antibody (70R-7453)

ST6GALNAC2 antibody (70R-7453) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST6GALNAC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST6GALNAC2 antibody (70R-7453) | ST6GALNAC2 antibody (70R-7453) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors