ST6GALNAC6 antibody (70R-6867)

Rabbit polyclonal ST6GALNAC6 antibody raised against the C terminal of ST6GALNAC6

Synonyms Polyclonal ST6GALNAC6 antibody, Anti-ST6GALNAC6 antibody, St6 -N-Acetylgalactosaminide Alpha-26-Sialyltransferase 6 antibody, STGALNAC-6 antibody, ST6GALNACVI antibody, RP11-203J24.3 antibody, STGALNAC-6, STGALNAC 6 antibody, SIAT7F antibody, STGALNAC 6, ST6GALNAC6
Specificity ST6GALNAC6 antibody was raised against the C terminal of ST6GALNAC6
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen ST6GALNAC6 antibody was raised using the C terminal of ST6GALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
Assay Information ST6GALNAC6 Blocking Peptide, catalog no. 33R-10129, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC6 antibody

Images

Western Blot analysis using ST6GALNAC6 antibody (70R-6867)

ST6GALNAC6 antibody (70R-6867) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ST6GALNAC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ST6GALNAC6 antibody (70R-6867) | ST6GALNAC6 antibody (70R-6867) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors